|
|
Cat. No |
Model |
Description |
Unit |
Price (VATº°µµ) |
³³±â |
Àç°í |
DataSheet |
ÁÖ¹®/°ßÀû |
LCA-23-315639 |
NB300-701 |
E2F1 Antibody//Human/Rabbit |
1/EA |
|
|
|
|
¹®ÀÇ |
|
|
|
|
|
|
Subject
|
E2F1 Antibody |
Description
|
/ Human/Rabbit |
Clonality
|
Poly |
Company
|
Novus biologicals |
Application
|
IHC-P, IP, Western Blot |
Conjugation
|
|
Immunogen
|
|
Contents
|
Description:Summary: Species: | Hu | Applications: | WB, IP, IHC | Clonality: | Polyclonal | | Gene: | E2F1 | Purity: | Immunogen affinity purified | Host: | Rabbit | | Specificity: | The does not cross reacts with other proteins of the E2F family members. | Publications: | Antibody has not yet been mentioned in a publication. | Details: Isotype: | IgG | Immunogen: | Synthetic peptide: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD, corresponding to amino acids 58-93 of Human E2F1. | Localization: | Nuclear | Gene Symbol: E2F1 Entrez: | 1869 (Human) | Related Genes: | ARID4A, CDKN1A, CDKN2A, TP53, CDK2, E2F4, RB1, CDK4, E2F3, E2F2, CCND1, TCEAL1, D4S234E, RBL1, MYC, RBL2, TFDP1, CCNA2, PCNA, RAB3GAP1, NOLC1, E2F5, PAK3, DCTN6, SSSCA1, IFI27, PSMD9, MDM2, SLC12A9, CDKN1B, BCL2, DHFR, CDC2, CASP3, TP73, SP1, ARHGAP24, NOL3, BAX, DAND5 | Species: Reactivity: | Cross-reacts with Human. Not yet tested in other species. | Applications: Uses: | Immunohistochemistry, Immunoprecipitation and Western Blot Detects a band of approximately 53 kDa. Optimal dilutions/concentrations should be determined by the end user. | Dilutions: | immunohistochemistry assay dependent, immunoprecipitation assay dependent, Western Blot 1/1000 | Concentrations: | 1.0 mg/ml | Packaging: Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | Preservative: | No Preservative | Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. | |
|
|
|
|