| Catalog Number | GTX14230 |
| Product Name | D4 GDI antibody |
| Product Description | Chicken polyclonal to D4 GDI |
| Synonyms | 397 | ARHGDIB | 602843 | P52566 | D4 | GDIA2 | GDID4 | LYGDI | Ly-GDI | RAP1GN1 | |
| Background | D4 GDI belongs to the family of Rho GDIs or GDP dissociation inhibitors for the Rho/Rac family of small G proteins; consisting of RhoGDI 1, D4 GDI/RhoGDI2 and Rho GDI3. It inhibits the release of GDP from the Rho proteins, essential for GTP loading and activation of GTPase activity. D4 GDI is located in the cytoplasm and in involved in the regulation of the membrane association and dissociation cycle of Rho/Rac proteins. It is known to be a substrate for caspase 3 during Fas mediated apoptosis. |
| Clonality | Polyclonal |
| Host | Chicken |
| Isotype | IgY |
| Immunogen | Synthetic peptide: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDP , corresponding to amino acids 1-62 of Human D4 GDI. |
| Antigen Species | Human |
| Tested Applications | Western blot. The usefulness of this product in other applications has not been determined. |
| Application Note | For WB: Use at an assay dependent dilution. Predicted molecular weight: 23 kDa. Not tested in other applications. Optimal dilutions/concentrations should be determined by the researcher. |
| Species Cross Reactivity | Human, mouse, rat and cow - Not tested in other species |
| Target | D4 GDI |
| Cellular Localization | Cytoplasmic and Nuclear |
| Form Supplied | Liquid |
| Purification | Affinity purified with antigen |
| Storage Buffer | PBS, no preservatives added |
| Storage Instruction | Keep as concentrated solution. Store at 4ºC short term. For extended storage aliquot and store at -20ºC or below. Avoid freeze-thaw cycles. |
Image:img24655.jpgWestern Blot: GTX14230 at a dilution of 1:2,000 against a D4 GDI fusion protein. Print:Print
