|
| |
| Cat. No |
Model |
Description |
Unit |
Price
(VAT별도) |
납기 |
재고 |
DataSheet |
주문/견적 |
| LCA-23-351811 |
GP-029-50 |
Agrp Antibody//Sheep/Guinea |
1/EA |
|
|
|
|
문의 |
|
|
|
|
|
|
|
Subject
|
Agrp Antibody |
|
Description
|
/ Sheep/Guinea |
|
Clonality
|
Mono |
|
Company
|
Novus biologicals |
|
Application
|
IHC-P |
|
Conjugation
|
|
|
Immunogen
|
|
|
Contents
|
Description:Summary: | Protein Type: | Peptide | | Species: | Sh | | Applications: | IHC | | Clonality: | Polyclonal | | | Gene: | AGRP | | Purity: | Whole antisera | | Host: | Guinea Pig | | | Specificity: | agouti related protein | | Publications: | Antibody has not yet been mentioned in a publication. | Details: | Immunogen: | A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCS RT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response. | Gene Symbol: AGRP | Entrez: | 181 (Human) | | | P56473 (Mouse) | | Related Genes: | POMC, NPY, LEP, CARTPT, MC4R, MC3R, INS, TRH, LEPR, NOL3, ARC, CRH, MSX2, PMCH, MC1R, HCRT, TUBB3, GH1, GGH, PYY, CCK, IAPP, DAP, DNPEP, HEBP2, STAT3, GHSR, KIAA0020, FOS, BDNF, HOMER1, TAP2, NR3C2, TNFRSF11A, CGA, MC5R, PLOD1, PIK3CG, MRS2, GLP-1 | Background: AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats. Species: Applications: | Uses: | Immunohistochemistry IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. | | Dilutions: | immunohistochemistry 1:2000 | Packaging: | Buffer: | Lyophilised | | Storage: | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | | Preservative: | No Preservative | | Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. | | | | |
|
|
|
|
